If everyone isn’t vaccinated, then it’s pointless

You realize the vaccines don't keep people from getting covid right, just from getting very sick. If anything, your unvaxxed family members should be afraid of you guys...not the other way around.

[link to www.youtube.com (secure)]

Just git that vax, peeps!

You've been brainwashed by the snake-oil OP. It's not a vaccine. It's a new technology never used on this scale on humanity that wears off in 6 months requiring boosters for life.

Figure it out... you're a slave to big pharma having your freedoms stripped out of fear of a cold forever destined to get injections of experimental vaccines without proper human testing and overview.

But if that is the future you want to live in and be enslaved and exploited by the Davos group and corrupt Big Pharm then by all means roll up that sleeve and get your 'clot-shot'.

We won't stop you.

does the vaccination protect you or not?

if unvaxxed people have the MAGICAL POWER to void the vaccination, then what's the point of getting it?

when will you figure out it just doesn't work?

According to you it’s better to get very sick than not to.

It protects everyone if everyone gets it.

the biggest dipshits on earth
still buying Dr Fauci's Traveling Snake Oil scam.

are you and that male bouncer you met at the strip club in san francisco going to share thanksgiving together? you guys going to pull on the wishbone and make a wish?

I hope things are working out for you guys..you were pretty excited a few months back when you came online and gushed about him.

You must be trolling!
Holy fuck!
You CANNOT be serious...

SCIENCE!

This is just the reality. Just because it’s not sexy doesn’t make it not real. Just because it don’t sound good don’t make it not real. Yes you must be fully vaccinated and get boosters. That’s in addition to living a healthy lifestyle. It’s free and easy to get the shots, so big pharma isn’t making money off of us.

:notstraight:

the fact that you would outcast a family member over a shot that won't even keep you from getting covid just shows you're the real piece of shit, not her.

of course, we know youre trolling, because you couldn't possibly be this retarded, but anyway...

"the vaccine protects me as long as nobody has covid".

what idiots.

hey, guess what? my dirty underwear will protect you,
too, if nobody has covid.

The only thing it does is guarantees more escape and more mutation. You are fairly uneducated on the matter.

Honey, that’s just not science.

I have thirty years of vaccine knowledge and awareness, herd immunity is fallacy.

They have fed you the propaganda to an extreme, you are indoctrinated with extravagant falsehoods.

A. The shot in question is not a vaccine, never was.

B. The shot in question is not only not preventing spread of said viruses, it is actually fomenting spread, according to world data and statistics from the only reputable sources we are privy too as underlings, they admit it’s failures.

C. Your ignorant advice could get people killed, you are culpable if they follow your directives on the matter.

On the contrary, they are making huge profits on you. And no, getting 2 'experimental' gene-therapy shots for 6 months of protection requiring 'boosters' for life isn't a vaccine.

You think mRNA gene-therapy is safe and effective?

Think again... The gene-therapy mRNA reprograms the cell to produce a viral component. It's a synthetic spike-protein sequenced in a lab by a computer and has multiple kill-points that will cause 100% mortality within 10 years for anyone who took it.

The PRION encoded in the spike-protein

The most deadly aspect of this kill-shot is the genetic sequence contains a 5 GxxxG prion motif which will be a slow-onset of neural degenerative diseases and already we are seeing a uptick in CJD or crutzfeild-jakobs disease in Phizer vaccinated patients. CJD is 100% fatal!

This has been confirmed by many people in the industry and you can also prove it yourself by running the synthetic gene sequence for this spike protein through PLAAC and the dip at 500 is the prion motif.

Here is the gene-sequence.
[link to www.uniprot.org (secure)]
>sp|P0DTC2|SPIKE_SARS2 Spike glycoprotein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=S PE=1 SV=1

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFF​SNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV​NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEG​KQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLL​ALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTL​KSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVAD​YSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKL​PDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGF​NCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLT​GTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQV​AVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAG​ICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVS​MTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKT​PPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICA​QKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQ​NVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAIS​SVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLG​QSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFV​SNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFK​NHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWL​GFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT

Here is PLAAC, copy and paste the gene-sequence run it for yourself and it spikes at 500 which is the prion.
[link to plaac.wi.mit.edu]

SARS-CoV-2 Prion-Like Domains in Spike Proteins Enable Higher Affinity to ACE2
[link to www.preprints.org (secure)]

This is why it caused Lewy Body disease in the Macaque monkey studies.
SARS-CoV-2 causes brain inflammation and induces Lewy body formation in macaques
[link to www.biorxiv.org (secure)]

A video on the Prion findings...


[link to www.bitchute.com (secure)]

It's catching some attention:
Scientist sounds alarm: COVID vaccines producing symptoms of Parkinson’s, other neurodegenerative disorders
[link to www.lifesitenews.com (secure)]

Here are a couple of scientific studies on the brain lesions this is causing ie ... real brain damage.

Acute transverse myelitis following SARS-CoV-2 vaccination: a case report and review of literature

[link to www.ncbi.nlm.nih.gov (secure)]

More studies showing vaccine causing brain lesions...!!!
COVID-19 mRNA vaccination leading to CNS inflammation: a case series
[link to www.ncbi.nlm.nih.gov (secure)]
The SPIKE-PROTEIN is part of the Sars-Cov-2 Pathology!

The second deadly aspect is that the spike-protein itself is toxic and part of the Sars-Cov-2 pathology meaning it causes inflammation. We know this from research on the spike-protein itself and it is the only part of the virus that binds to IL-8 proteins in the lung that causes inflammation.

Induction of IL-8 Release in Lung Cells via Activator Protein-1 by Recombinant Baculovirus Displaying Severe Acute Respiratory Syndrome-Coronavirus Spike Proteins
[link to www.jimmunol.org (secure)]

SARS-CoV-2 spike protein induces inflammation via TLR2-dependent activation of the NF-κB pathway
[link to pubmed.ncbi.nlm.nih.gov (secure)]

The novel coronavirus’ spike protein plays additional key role in illness
[link to www.salk.edu (secure)]

SARS-CoV-2 Spike Protein Impairs Endothelial Function via Downregulation of ACE 2
[link to www.ahajournals.org (secure)]

This leads to two specific areas where death or injury can occur:

Myocartitis - Inflammation of the Heart.
Encephlatitis - Inflammation of the brain.

The other problem is our own immune systems response to our cells causing an immune-response where the cell presenting the spike-protein triggers the killer T cells to attack and kill the cell. If too many cells die this triggers a platelet response forming clots. Thrombosis or micro-thrombosis becomes and issue and this leads to heart attacks and strokes.

This is where we have the deaths that appear within 14 days of the shots for those who get the clots and die.

Of course the final death-blow comes from ADE as we know this is causing ADE in the UK/Israel as it takes 6-9 months for that problem to occur. Another slow-onset problem of this soft kill weapon.

Not to mention the death of CB8 Killer T-Cells causing a type of auto-immune disorder.

Feel free to debunk these fact-based medical findings and studies.

Pandemic of the brain washed.

Death Cult logic

OP already wears other guys dirty underwear as his face diaper. Don't encourage him.

sorry about your brains, OP.

maybe next life you'll get it.

That is kinda dumb, ain't it.

Not to mention what OP is whining like a little biotch about isn't about being sick, just about being unvakked, as if that's the same thing.

No one in this stupid play of OP's is sick, just paranoid and filled with fear.

No pity for stupidity and those too lazy to read and research.

Is this not important enough to do that?

Nope, according to me its better to know your sick and stay away from other people than create an army of asymptomatic people who can all be infected and not even realize it.