Godlike Productions - Discussion Forum
Users Online Now: 1,628 (Who's On?)Visitors Today: 1,110,704
Pageviews Today: 2,226,812Threads Today: 785Posts Today: 16,054
11:08 PM


Rate this Thread

Absolute BS Crap Reasonable Nice Amazing
 

FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects

 
Anonymous Coward
User ID: 84695276
United States
11/03/2023 02:13 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
I’ll be honest if you go way way way back in this thread I was a doctor who downplayed covid as a fear campaign to restrict people and tee them up for the other bioweapon. I made a tactical error. Hell I think I even trolled some and poked at jazz. Fast forward a year after my first lc patient came in. I became a true believer albeit from learning the hard way. It led me to an insanely intense experience of being shattered to the lowest point of my life to crawl back up to were I am now.

This thread it’s ops it’s posters it’s intel it’s resources uncle dooms helping hand towards bcov milk saved my life.

To have driven by a prayer to mix and match things that seem to have been helpful for others by experts I have never met and the wild meeting of a mystery man on Twitter clearly linked to uncle doom validating it all. Has both humbled me shaken me and blown my mind.

Seeing the reality that front line individuals are being harmed and killed by this plague is unsettling.

Been a weird day for me lots of emotions surges of worry confusion appreciation. The spectrum. I hope in heaven the full story can be told to me at what level my hodge podge supplement salad did for the world and who got ahold of it. This is twice it’s been told it was instrumental for many.

You have to understand my position. I am just a hillbilly country doc chiro trying to uphold the philosophy of dd and bj Palmer. Sid Williams and the dead chiros before me. Struggling to maintain a small practice against all odds with long covid and a embezzling employee (I think subconsciously assigned to try to destroy me at this critical juncture while researching and self medicating daily with extreme syntoms).

The strangest life I have ever known. One hell of a mid life crisis.

I may be lurking for awhile to collect myself but put up the bat signal on f you need me


God bless uncle doom all here all connected
God bless the mystery Twitter man
God bless the suffering
God bless the British nurse.

Lc doc signing out.
S-man

User ID: 85069399
Norway
11/03/2023 02:23 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
LC Doc - thank you.
And God bless you, too!

I will integrate your last additional items into the OP this weekend.

All the best to you. :)
Pe$ky

User ID: 86487976
Czechia
11/03/2023 02:33 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Thought I’d drop this off

Hope everyone’s well

DRUG DEAL Urgent warning as common antibiotics are ‘no longer effective’ treating children – fuelling a surge in deaths

[link to www.thesun.co.uk (secure)]
Anonymous Coward
User ID: 84695276
United States
11/03/2023 02:33 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Last thought.

I haven’t been able to penetrate or get much spread of this protocol in the us unless it’s in the back ground. I have had people
Tell me I need to advertise it. I will not. Last thing I need is fda or worse or publicity for 20 to 50 million lc patients showing up to my neck of the woods. 1. My scope of practice I can’t make that claim. 2. I have a small parking lot lol. 3. God told me I cannot profit from it nor would I on moral grounds.

If others see benefit with individuals who use it. If they tell 10 people and so. On and so forth. Maybe a percent gets better maybe more I dunno. It’s beyond my energy reach or bravery to endeavor. I believe that was the plan to get it to the right people who can science it test it trial it and see is it worth a shit or not and to whom or what lc profiles benefit.

It’s nearly a spread of supplements with certain benefits for nutritional benefit of the body. Not a cure. Just advise a flash light on a confusing path or maze. If those with the ability see fit maybe it gets handed to anybody in need.

With all the research the best the big brains at Harvard etc etc have come up with is Prozac paxlovid exercise therapy hyperbaric chambers ivig a few peptides and recently acyclovir all seemingly falling short of true lasting mitigation. Of course lc victims await the mythical bc007 or ampligen

The Calvary isn’t coming and if they do it will be a decade or longer.
Anonymous Coward
User ID: 84695276
United States
11/03/2023 02:34 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Thought I’d drop this off

Hope everyone’s well

DRUG DEAL Urgent warning as common antibiotics are ‘no longer effective’ treating children – fuelling a surge in deaths

[link to www.thesun.co.uk (secure)]
 Quoting: Pe$ky


When your tcells cd8/4 are exhausted antibiotics won’t have the support not shocking at this late stage.
JAZZz50

User ID: 86311309
United States
11/03/2023 03:02 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Thought I’d drop this off

Hope everyone’s well

DRUG DEAL Urgent warning as common antibiotics are ‘no longer effective’ treating children – fuelling a surge in deaths

[link to www.thesun.co.uk (secure)]
 Quoting: Pe$ky


this has a triple wammy to it.

1> it's cover for failed vax and covid damage

2>"They put it down to antibiotic resistance, which the WHO has said is one of the 10 major public health threats facing humanity." SuperBugs has been a warning for a decade or so. this won't matter if u are vaxed and covid free.

3> the germs are stronger- merges.

quoted from article "The United Nations predicts it will cause up to 10million deaths by 2025." add this to the excess death charts.

note- study claims the worst is the Asia-Pacific regions. have noted there are several nastys there with high case #'s. a revolving door med system could cause the high #'s. so would a super "XYZ" outbreak. did cover some in the "Outbreak" thread last year.

i should mention this with the word merges- we still do not know what all was mixed together in making covid. hence, a merge may not mean every part of covid is merged. we may need to lighten the technical definition to include enhances mutations in other nastys.

i also mention that 1 of my concerns has always been that the Doom merge might not b a monster that we think of like EBOLA but come as a kitten with alligator teeth.
JAZZZ50

2020 The SHTF literally as TP ran out.

we went from being over the target, to actually being the target. too close to the truth.


if i had a dollar for everytime someone says "merge" without using the word, i'd b so green i'd b King of Mars.
S-man

User ID: 78711403
Germany
11/03/2023 04:00 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
JAZZ, I was just having my extra-turmeric, Black Pepper with Nigella Sativa seed curry, and I was thinking - you need to know you didn't do anything wrong if you responded off-handed to the GB Nurse to begin with.. we've all been subjected to a lot of trolling these past years. Heck, I almost deleted the first post "can I post without a username" last night, before I went to bed. Glad I didn't but almost did.

I am sure GB nurse would forgive you for the misunderstanding, because that's all it was.


PS Pe$ky thanks for the info drop.
FYI We are mourning Uncle Doom.

Any antibioitic resistance to Kanamycin or Neomycin could likely come from the contamination of the bacterial growth plasmids (the plasmids have the Kan / Neo resistance genes in them by design, to allow the bacteria to grow and make mod-mRNA - whilst allowing Pfizer to add Kanamycin/Neomycin to the mix to kill of any pollluting undesirable bacteria.


Typical of them to blame their error on us.

Last Edited by S-man on 11/03/2023 06:35 PM
JAZZz50

User ID: 86311309
United States
11/03/2023 04:11 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
thanks SMAN.
JAZZZ50

2020 The SHTF literally as TP ran out.

we went from being over the target, to actually being the target. too close to the truth.


if i had a dollar for everytime someone says "merge" without using the word, i'd b so green i'd b King of Mars.
Dosha

User ID: 77473202
United States
11/03/2023 10:44 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Some simple natural ingredients that may help mitigate covid symptoms. We already are hip to the dairy thanks to info from UD, but pectin (citrus, pomegranate peel, rhubarb and apples) also may be additionally worth trying.

We are not powerless. hf



Galectin-3 inhibition for CoV is in the news - Epoch Times News

Modified citrus pectin, pomegranate inner pith, rhubarb, and apples are sources of pectin which is an inhibitor. So is milk sugar - lactose.

JENNIFER DEPEW, R.D.
NOV 3, 2023

...Galectin-3 and the key to relieving Covid-19 symptoms. (theepochtimes.com)

...Elevated galectin-3 is inflammatory and elevated levels may play a role in liver, kidney or heart disease. It is also used for cancer treatment. Citrus bioflavonoids and pectin is also used for weight control and Metabolic Syndrome.

Pectin and milk sugar, lactose, helps inhibit galectin-3 effects.

[link to denutrients.substack.com (secure)]
Dosha
Anonymous Coward
User ID: 86489496
France
11/04/2023 01:45 AM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
...and MARIJUANA
S-man

User ID: 85018018
United States
11/04/2023 09:47 AM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Dosha, I do remember waaaay back that some people were swearing by pomegranate! Thanks.
S-man

User ID: 85018018
United States
11/04/2023 09:48 AM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Thread: Evidence of DIRECT CARDIOTOXICITY of mRNA 'non-vaccines' (b/c they are NOT vaccines)
Evidence of DIRECT CARDIOTOXICITY of the 'vaccines':
12-Oct-2023. Journal: British Journal of Pharmacology
========================================

Hidden cardiotoxic effects of mRNA-1273 and BNT162b2 on ventricular myocyte function and structure
"Here we demonstrated for the first time, that in isolated cardiomyocytes, both mRNA-1273 and BNT162b2 induce specific dysfunctions that correlate pathophysiologically to cardiomyopathy."

"Both RyR2 impairment and sustained PKA activation may significantly increase the risk of acute cardiac events."


----------------

note: this means myocarditis is not even needed to cause cardiac death-by-vaccine!
...and we've already got ample evidence of that...
Thread: Myocarditis from the JABS -not covid- Here is the evidence I gathered. Counter the junk journalism!
 Quoting: S-man
S-man

User ID: 85224276
United States
11/04/2023 09:52 AM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Autopsies find 'vaccine' and 'myocardial injury' in hearts of deceased vaccinated px..

27-Sep-2023. Journal: npj Vaccines
=================================

[link to www.nature.com (secure)]
"Vaccine was detected in the myocardium in a subset of patients vaccinated within 30 days of death."

"Cardiac ventricles in which vaccine was detected had healing myocardial injury at the time of vaccination and had more myocardial macrophages than the cardiac ventricles in which vaccine was not detected."

"These results suggest that SARS-CoV-2 mRNA vaccines routinely persist up to 30 days from vaccination and can be detected in the heart."
Dosha

User ID: 77473202
United States
11/04/2023 02:27 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Dosha, I do remember waaaay back that some people were swearing by pomegranate! Thanks.
 Quoting: S-man


thumbs
Dosha
JAZZz50

User ID: 86311309
United States
11/04/2023 11:51 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
PLAGUE in wildlife in COLORADO is normal. this time thou it is a domestic animal. county is north of Denver and includes FT Collins. last case in the county was over 7 years ago.

"The people known to have been exposed to the animal were recommended antibiotic treatment to prevent plague from developing, LCDHE said. Signs will be posted in the area and neighbors will be notified on NextDoor about what precautions to take."

[link to kdvr.com (secure)]
JAZZZ50

2020 The SHTF literally as TP ran out.

we went from being over the target, to actually being the target. too close to the truth.


if i had a dollar for everytime someone says "merge" without using the word, i'd b so green i'd b King of Mars.
Anonymous Coward
User ID: 86494330
France
11/05/2023 05:33 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Whoaa I guess I'm not the only one feeling a shock from reading the last few pages of this now very long discussion / thread ...

As some of you guys stated, if this was a LARP, it was a top-notch one, maintained over years and with a grand final.

I actually wish it would be just a LARP, but I feel genuine sorrow when trying to hold together all the parts of the equation... Yes that man was most probably real given his level of knowledge and how months after months we were able to correlate his speculations.

Of course we're all rambling, "a spike is a spike is a", etc, - but given the gravity of the situation, how unfathomable it appears, who wouldn't go crazy trying to discern what's going on ?

We all have our limits, and it certainly seems like we're peering through something bigger than all of us can swallow.

Now, we really need to try and get our sh*t together, in order to get a grasp on what the actual fuck is happening.

For years, we heard about weird, fringe stuff like morgellons, smart dust, voice2skull tech...

I know for fact, having been in contact with physicists working with big ass mass spectrometers, etc, that high altitude spraying of complex nanotech is real, and has been ongoing for decades.

Now, coming to the topic of this discussion : so, I understand we're at the stage where we:
- on one hand, empirically see that novel structures are appearing inside of the bodies of the general population : at this stage, I guess we can safely state that the "clot material" extruded from the veins of dead bodies by embalmers is a side-effect of that tech : the point may not be to kill, but in some instances, as with all new techs, you have "collateral damage".

I think that their end goal is more about total control, than just to make a big slaughter.

We really need to dig further into all possible directions - and so yes, it is relevant to be looking for weak signals in the RF/HF/UHF/microwave spectrum nearby vaccinated individuals, but one need proper tools and knowledge to do so in a scientific fashion, and not just like another wannabee apocalypse grifter prophet of the new age, ready to sell you "anti-5g" patches
Anonymous Coward
User ID: 86494330
France
11/05/2023 05:37 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
We'll try our best to honor your memory, UD, you were the best.

Keep on investigatin' da shit
S-man

User ID: 83749032
Poland
11/05/2023 06:21 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Whoaa I guess I'm not the only one feeling a shock from reading the last few pages of this now very long discussion / thread ...

As some of you guys stated, if this was a LARP, it was a top-notch one, maintained over years and with a grand final.

I actually wish it would be just a LARP, but I feel genuine sorrow when trying to hold together all the parts of the equation... Yes that man was most probably real given his level of knowledge and how months after months we were able to correlate his speculations.

Of course we're all rambling, "a spike is a spike is a", etc, - but given the gravity of the situation, how unfathomable it appears, who wouldn't go crazy trying to discern what's going on ?

We all have our limits, and it certainly seems like we're peering through something bigger than all of us can swallow.

Now, we really need to try and get our sh*t together, in order to get a grasp on what the actual fuck is happening.

For years, we heard about weird, fringe stuff like morgellons, smart dust, voice2skull tech...

I know for fact, having been in contact with physicists working with big ass mass spectrometers, etc, that high altitude spraying of complex nanotech is real, and has been ongoing for decades.

Now, coming to the topic of this discussion : so, I understand we're at the stage where we:
- on one hand, empirically see that novel structures are appearing inside of the bodies of the general population : at this stage, I guess we can safely state that the "clot material" extruded from the veins of dead bodies by embalmers is a side-effect of that tech : the point may not be to kill, but in some instances, as with all new techs, you have "collateral damage".

I think that their end goal is more about total control, than just to make a big slaughter.

We really need to dig further into all possible directions - and so yes, it is relevant to be looking for weak signals in the RF/HF/UHF/microwave spectrum nearby vaccinated individuals, but one need proper tools and knowledge to do so in a scientific fashion, and not just like another wannabee apocalypse grifter prophet of the new age, ready to sell you "anti-5g" patches
 Quoting: Anonymous Coward 86494330


Yeah, I don't think UD was a larp.

To your point, what could be more assistive of the 'control' agenda than making our antibiotics useless (Kanamycin, Neomycin resistance in vaxxes transferrable to host biome bacteria..)
.. and using Paxlovid as a basic 3CLPro inhibitor, to teach the virus how to evade one of the more important mechanisms of Ivermectin ??


I have refrained until last week from speaking on the nanotech nanomaterials side, but seeing the Pfizer undeclared ORF matching closest to spider silk, not just any silk but dragline silk. The strongest.
And its relation to hydrogels..
[link to www.nature.com (secure)]
Spidroin N-terminal domain forms amyloid-like fibril based hydrogels and provides a protein immobilization platform

I am beginning to think:
1) Hanlon's Razor no longer applies.
2) the real weapon was the vaxxes (why else carry on with extinct spike for 2y, other than that was the most damaging one)
3) the OG Wuhan-1 strain was a weapon, likely released by mistake, too early?... They knew it would eventually blend into the background somewhat (I was originally worried it was becoming more pathogenic), but Africa saved mankind - as UD put it...

EDIT to add:
4) The virus and the vaxxes were obviously military/CIA operations - see DEFUSE docs, Latypova's talk in Sweden etc..
5) This whole thing about EUA for vaxxes (to the exclusion of HCQ, Ivm etc), was about PROVING our military stance toward countermeasures for deterring bio-terrorism. This obviously has failed.
6) A lot could be improved if we could find a way to make it profitable to re-use/re-purpose old drugs, you know the ones with a proven safe track-record.

Last Edited by S-man on 11/05/2023 06:57 PM
S-man

User ID: 81752332
Norway
11/06/2023 06:55 AM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Jessica Rose did a really good job analysing the links to spider-silk and the risks/uses in humans. Some good Electron Microsope images, too:

[link to jessicar.substack.com (secure)]
"when Kevin BLASTed this ORF in UniProt, he found that it has weak sequence homology (25.3%) to Major ampullate spidroin 1 MaSp1."

"This MaSp1 is one of 2 types (the other one is MaSp2) used to make a specialized type of spider silk"

"Are superfluous whoopsie proteins being made in some people who were injected with the modified mRNA COVID-19 products?"

"Dragline silk has incredibly high tensile strength and ductility (flexible) making it perfect as the spider’s bungy-jumping lifeline."


hmm.
"This is why humans are so interested in copying it for repurposing as biomaterials."
"In fact, it is actually tougher than both kevlar and steel."
"It’s absolutely mind-blowing to me that Draglines also have torsional memory."

hmmmmmmm:
"You might also find it interesting that as far back as 2011, there have been published works on introducing recombinant silk proteins into mammals for ‘regenerative medicine’"

hmmmmmmmmmmmmm:
"Furthermore, fibers developed from spidroin are tolerated in vitro, in cell culture, and in vivo, in animals like pigs, as no signs of either inflammatory response nor body reaction were shown to these fibers."
These results suggest that they could be used in medicine without risk of biocompatibility issues and thus potentially lead to many new opportunities

 Quoting:
S-man

User ID: 83664438
United States
11/06/2023 07:40 AM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
I examined the mystery ORF/protein in pfizer.
================================================

Sequence (without spaces, one long line..):
MQYQLESSCVVQFHALQHGLRIVLVELAAAATATTALQAATAAGHATQHDCDHHDGNQ​SGDKAQPDVPGPLDVLLVLPQFLQVDQALVQILGHLVQPVDLFLDVHDAGIDSADIAQVHV​GACVVLKVLVQFLFEAVQLGLQRVVHGIVHNADHDVAVARHEGVVGGDDLGLVEVPLCHEP​MGAVGHEHAFSRKVGFAVVADGWSGGEILLLSGHICHVQKHHAVRGRLREAHQVVALAAKV​HSLALAQHTLRHLGGGQIGRGSNLGGSDQLLGHVCLEALQSACDQSVDLHLGLRRVQSAQD​IVQHRADGAELGGQLLDQGVQCLGIVVDHVLQLSQGACCAAQAVLDLADGAVELVGDQLLV​LVQHILGHSDAVEPVGHLHSKGDLQSGACSKCPAACDCAGQQGRCVLGDHLIGQQRRQHCQ​SVKLLGANQIPGGNVAQTIAILLDEAGVGQCHFVEQQVLDEAPLAGLARIGQNLAEIEAAE​VLDRRGLVDLLHLGEHLLGVLVLFHGDPCQGSFQLGAEAAVLQQQVGALGGIAADVHGAVH​AGLGHGHRQDLCGHADGEVGGDSDRVVGVGHAVLGAQRHCVGNDALAGHASGSPVALCLCL​VAGADSSADGDVALVAIVHVLGSDQTAGSGLKHIAAGGVHPPCRCQLIGVNGHGHFGTVHA​LVQHCHLIAGVGARGDHRHSAEAARGDVQDFQCLGISNGVCGIGDIPAKLLEWQELLVALC​QHAGAGQAVEVEVHAFVLHEIGAFLRAAHCGRGMQQFEAQHHHSVGLVAHAVCGPKAVGLQ​WEVAVHACHAVTRLVAGLIDLGGDVPLEGLQIGLPEQPVPVIVVAADFGVQLVAVPGNHTA​GEVVGQLVVVVGDVACLSRGNLPHFVSPDHEAVGVHVCEAQVVQLGRGHAVALECEEGGEV​VQHGVVGHAIADPLPVPGVHRGESGGIEHLVEGAQIGDIGEPHDGFGGLHPEVAGLVDALF​HGEGLQGALCLAQRIQSTIHGVGDGAVLVVLQQEGSRLQVAHIVSGGTSCPSAAAIARCQV​ASVQGQQCLKPGDVDADGQIHQGFQSREALRQIPAEVDRGVLAVDLEVAVDVLKHELAQVL​EVALLAFQVHQERLGHVLEGAVVGAAVHPELAFHPALVVLVVVDVQEGVVAELELAHFDDH​VGGVVHDQQALGLAVQCGAEDPASDDVGLLGAGKVHPVVEGQHGVVESLGAIGAGDGVEPG​HVAEERQEQVLGRVQHAGSEHLVGVVHASGKAVGV
 Quoting:


In PLAAC (plaac.wi.mit.edu):
RESULT 1: [link to ibb.co (secure)]
PLAAC run: [link to plaac.wi.mit.edu]
..nothing special, I would say.

in WALTZ (HARD TO FIND - go to waltz.switchlab.org/ for the form entry):
[link to ibb.co (secure)]
[link to waltz.switchlab.org (secure)]

-> There are amyloidogenic regions found by WALTZ, but only low signal for the priongenic tendency in PLAAC.
Anonymous Coward
User ID: 86494330
France
11/06/2023 10:00 AM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Jessica Rose did a really good job analysing the links to spider-silk and the risks/uses in humans. Some good Electron Microsope images, too:

[link to jessicar.substack.com (secure)]
"when Kevin BLASTed this ORF in UniProt, he found that it has weak sequence homology (25.3%) to Major ampullate spidroin 1 MaSp1."

"This MaSp1 is one of 2 types (the other one is MaSp2) used to make a specialized type of spider silk"

"Are superfluous whoopsie proteins being made in some people who were injected with the modified mRNA COVID-19 products?"

"Dragline silk has incredibly high tensile strength and ductility (flexible) making it perfect as the spider’s bungy-jumping lifeline."


hmm.
"This is why humans are so interested in copying it for repurposing as biomaterials."
"In fact, it is actually tougher than both kevlar and steel."
"It’s absolutely mind-blowing to me that Draglines also have torsional memory."

hmmmmmmm:
"You might also find it interesting that as far back as 2011, there have been published works on introducing recombinant silk proteins into mammals for ‘regenerative medicine’"

hmmmmmmmmmmmmm:
"Furthermore, fibers developed from spidroin are tolerated in vitro, in cell culture, and in vivo, in animals like pigs, as no signs of either inflammatory response nor body reaction were shown to these fibers."
These results suggest that they could be used in medicine without risk of biocompatibility issues and thus potentially lead to many new opportunities

 Quoting:

 Quoting: S-man


Thanks a lot for this most excellent, and important read !

I thoroughly agree with your thinking. It really looks like were seeing some concrete applications of prion / amyloid production and manipulation technologies which have been elaborated over a long period.

Thanks to how our current scientific institutions work, pretty much none of those hundred of thousands of research scientists would have been able to "get the picture", if indeed there is one. I'd say Hanlon's razor still apply there.

But coming to this manufacturing "process n°2", the confirmed presence of this DNA plasmid in amounts which are orders of magnitude higher than the allowed threshold, how they deliberately removed the SV40 promoter mention from the plasmid used in this "process n°2", while offering to their own employees a "special" batch,...
I don't mean to be exhaustive here in listing all of these "smoking gun" facts. Just pointing at the fact that when one correlate these to one another, there can't be anymore doubts: yes, this was deliberately crafted, and not the result of "rushing speed at warp-speed and then tripping on our ignorance".

Now, are these amyloid aggregates that will clump up small blood vessels are all there is to see here, meaning their only purpose is this - to decrease oxygen intake, thus making you dumber like a beta, gamma or delta class like in Aldous Huxley's Brave new world (I bring this up as we know how his brother Julian was a prominent figure in elite e-u-g-en-ists who wholly influenced and built the present paradigms in biology) ?

Or are there some more complex targets which are being aimed at here ?

The list of proven concerns is already pretty beefy. First coming to my mind, fertility problems - I have no means to properly verify this, but if indeed the number of miscarriages worldwide is increasing, that would be a direct match to the warning we had three years ago, about how certain regions of the spike protein have very high similarity to crucial placenta proteins.
(if these placenta proteins are recognized by the host immune system as antigens, then it seems pretty logical this would result in a miscarriage, or at least an increased probability of having one)

The topic of fabricated antibiotic resistance you were just discussing before is also very important, and will have pretty much the same result in the long run, as the cancer-inducing mechanisms we also know about : a "mild" increase of mortality, with virtually perfect non-liability.

These aspects are clearly about "soft" demographic control, but once again: is that all, or is this just a smaller part of it ?

We need no blind spot - the central nervous system is being targeted as well, but how deep and how complex is this attack ?

If this "amyloidic" clumping of blood vessels is the only one at play, while being easily countered by intake of polyphenols such as Curcumin, CBD, etc, ... I would see it as a way to "fossilize" the portion of the population which is still watching mainstream media in a closed mental loop - not killing them, but destroying their higher learning skills while keeping them *mostly* functional in their daily routine. Depending on the batch, the individual biologic makeup, and most importantly one's lifestyle (spicy foods, etc, etc), the effect and/or its offset would be more or less profound.

So once again, a mild, soft influence, with many ways to ensure at least temporary non-liability, and not something totally spectacular as seen in movies.

But, then, some of the things we've seen are still left unexplained.

I don't want to go too far into what will be blind speculation at this stage, just would like to point at where the more fringe commentators are pointing at as well : what if there is some kind of mind control component to this as well ?

But likewise, that would be a soft one - not something entirely dramatic such as turning oneself into a cannibal zombie, or a matrix agent, but more something to be used for crowd control - to be able to manipulate the collective emotions of a crowd via modulation of the limbic system, for instance.
As anything else biology-related, the efficiency could never reach 100 % - there would always be individual organisms more resistant to the influence, but that would still be alike to godlike power for the few having their hands on the buttons from above ?

I know, let's try and keep it simple, but there are so much stuff to look at, it's no less than overwhelming.

Once again my warm thanks for fueling this discussion with such rigor and wisdom S-Man, that's deeply appreciated to say the least.
S-man

User ID: 77173018
Germany
11/06/2023 02:01 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
worship

Thanks, France-AC.
I have to go to dinner now but your post deserves some thought. I would just say that a lot of this could be unlocked by some proper autopsies.

Autopsies where they actually look for amyloid etc.


And.. latest on birth rates isn't good:
[link to www.igor-chudov.com (secure)]
SWEDEN: [link to www.scb.se (secure)]
GERMANY: [link to www.destatis.de (secure)]
FRANCE: [link to www.insee.fr (secure)]
UK, I haven't seen any figures for about a year.
Anonymous Coward
User ID: 85131928
Germany
11/06/2023 06:16 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Oh, wow..

rumble.com/v3qyrp1-biowarfare-latest-sars-induced-syncytia-an​d-concomitant-staged-spike-releas.html


The section 2h6m-2h13m VERY WORTHWHILE WATCHING...seven minutes.
=============================================================​

2h 6m: Action on endothelium and brain.
2h10m30s: Bacteriophage activity confirmed. Electron Microscopy of bacteria filled with virus.
(2h14m30s)-> Very important to take antibiotics on infection, to kill the bacteria in the gut, nose etc. which are hosting the virus!
2h13m: Fantastic hand-drawn diagram showing mechanism of transfer through Blood-Brain-Barrier
2h14m: Another hand-drawn b&w flow chart for neurodegen mechanism.
2h16m10s: GFAP test confirmed. Confirmation of glia, astroglia getting hit..marker is up in most neurogdegen.
-> nice one Uncle Doom, on the GFAP!

EXTRA:
=========
2h30m: Sars2 can *fuse* Glia and Neurons together. "That really knocked me off my socks".
-> Again, hat-tip to Uncle Doom.

3h00m40s: "It's like the spike protein is practically booby-trapped."
-> If you break it up, you can cause more problems.

 Quoting: S-man


It seems the spike, once inside the body, is a very nasty problem.
I have found a solution how to prevent a possible re-entry into a cell, once the spike is released through detox.
It is a simple, small, molecule, which inserts into the spike and blocks it's ability to fuse.
This molecule is LINOLEIC ACID.

Once LA encounters a spike it will bind to the RBD within a pocket, with a very high binding-energy.
That pocket is a highly preserved region throughout all variants, that is why it works for ALL variants.

You can flood your system with linoleic acid, without being afraid of toxic effects.

I personally use Milk-Thistle oil, cold pressed:
1 tablespoon prophylactic, 3-4 tablespoons during acute infection.
I just brought my 93 year old mother (unvaxxed) through an infection.

[link to phys.org (secure)]

[link to www.nature.com (secure)]
S-man

User ID: 85444734
Austria
11/06/2023 06:34 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Oh, wow..

rumble.com/v3qyrp1-biowarfare-latest-sars-induced-syncytia-an​d-concomitant-staged-spike-releas.html


The section 2h6m-2h13m VERY WORTHWHILE WATCHING...seven minutes.
=============================================================​

2h 6m: Action on endothelium and brain.
2h10m30s: Bacteriophage activity confirmed. Electron Microscopy of bacteria filled with virus.
(2h14m30s)-> Very important to take antibiotics on infection, to kill the bacteria in the gut, nose etc. which are hosting the virus!
2h13m: Fantastic hand-drawn diagram showing mechanism of transfer through Blood-Brain-Barrier
2h14m: Another hand-drawn b&w flow chart for neurodegen mechanism.
2h16m10s: GFAP test confirmed. Confirmation of glia, astroglia getting hit..marker is up in most neurogdegen.
-> nice one Uncle Doom, on the GFAP!

EXTRA:
=========
2h30m: Sars2 can *fuse* Glia and Neurons together. "That really knocked me off my socks".
-> Again, hat-tip to Uncle Doom.

3h00m40s: "It's like the spike protein is practically booby-trapped."
-> If you break it up, you can cause more problems.

 Quoting: S-man


It seems the spike, once inside the body, is a very nasty problem.
I have found a solution how to prevent a possible re-entry into a cell, once the spike is released through detox.
It is a simple, small, molecule, which inserts into the spike and blocks it's ability to fuse.
This molecule is LINOLEIC ACID.

Once LA encounters a spike it will bind to the RBD within a pocket, with a very high binding-energy.
That pocket is a highly preserved region throughout all variants, that is why it works for ALL variants.

You can flood your system with linoleic acid, without being afraid of toxic effects.

I personally use Milk-Thistle oil, cold pressed:
1 tablespoon prophylactic, 3-4 tablespoons during acute infection.
I just brought my 93 year old mother (unvaxxed) through an infection.

[link to phys.org (secure)]

[link to www.nature.com (secure)]
 Quoting: Anonymous Coward 85131928

Thanks, AC.
This is not something I was aware of. We can add it to the OP for acute treatment ideas.

Looks like a kind of 'fusion inhibitor'..?
Anonymous Coward
User ID: 85131928
Germany
11/06/2023 09:23 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Thanks, AC.
This is not something I was aware of. We can add it to the OP for acute treatment ideas.

Looks like a kind of 'fusion inhibitor'..?
 Quoting: S-man


Yes, sounds like it:

“Our cryo-electron microscopy structure of SARS-COV-2 spike (S) glycoprotein reveals that the receptor binding domains tightly bind the essential free fatty linoleic acid (LA) in three compsite binding pockets. A similar pocket also appears to be present in the highly pathogenic severe acute respiratory syndrome coronavirus (SARS-CoV) and the Middle East respiratory syndrome coronavirus (MERS-CoV). LA binding stabilizes a locked S conformation, resulting in a reduced angiotensin-converting enzyme 2 (ACE2) interaction in vitro.“

and

FFA (The Free Fatty Acid)) binding stabilizes a locked S conformation, interfering with virus infectivity. We provide evidence that the pocket is conserved in pathogenic beta-coronaviruses (beta-CoVs) infecting humans. SARS-CoV, MERS-CoV, SARS-CoV-2, and VOCs bind the essential FFA linoleic acid (LA), while binding is abolished by one mutation in common cold-causing HCoV-HKU1. In the SARS-CoV S structure, LA stabilizes the locked conformation, while the open, infectious conformation is devoid of LA.“


[link to pubmed.ncbi.nlm.nih.gov (secure)]

Here you have it, and it's natural, cheap and non toxic.
Anonymous Coward
User ID: 85131928
Germany
11/06/2023 09:34 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
After clogging the virus in the blood, LA additionally suppresses the viruses which are already inside a cell:

"We also show now that linoleic acid supplementation suppresses virus replication inside cells. We anticipate that future variants will also contain the pocket, which we can exploit to defeat the virus." "
Anonymous Coward
User ID: 85131928
Germany
11/06/2023 09:58 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Well, LA is not completely safe:

Toxicity to Animals: Acute oral toxicity (LD50): 3200 mg/kg [Rat].

[link to hmdb.ca (secure)]


So, if a 100kg man drinks 320 gr of LA at once, then chances are 50% that he will die.
This data is hypothetical, as the above concentration in rats was only achieved through injection.
I am sure that he will get only this: :shitstream:
Anonymous Coward
User ID: 85131928
Germany
11/06/2023 10:01 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
BTW, my mom was also getting a lot of the other stuff, NAC, coll. silver, Isoquercitin, zinc etc.
Anonymous Coward
User ID: 85131928
Germany
11/06/2023 10:02 PM
Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
and, of course, HYPERICIN
JAZZz50

User ID: 86311309
United States
11/07/2023 12:28 PM

Report Abusive Post
Report Copyright Violation
Re: FOR CORONACOASTER: COVID-19 News, Info, Discussion /// Tracking the Spread of the Virus and its Effects
Thread: CDC - Younger adult death rate up 20% in 2023

note the spike in infants in 2022, the year of the vax.
oddly we don't see a spike in elderly in 2020 relative to other ages, like u'd expect.
the drop now for 5070 yr olds is also odd.
JAZZZ50

2020 The SHTF literally as TP ran out.

we went from being over the target, to actually being the target. too close to the truth.


if i had a dollar for everytime someone says "merge" without using the word, i'd b so green i'd b King of Mars.





GLP